PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02923.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 243aa    MW: 28125.7 Da    PI: 9.7189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02923.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-18550147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l ++v+q+G+++W++Ia+++  gR++k+c++rw++ 
  Rsa1.0_02923.1_g00001.1  5 RGHWRPAEDEKLRELVQQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 50
                             899*****************************.***********996 PP

2Myb_DNA-binding55.61.3e-1757100146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r+++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Rsa1.0_02923.1_g00001.1  57 RNPFTEEEEERLLASHRIHGNR-WSVIARFFP-GRTDNAVKNHWHV 100
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.726155IPR017930Myb domain
SMARTSM007171.4E-14453IPR001005SANT/Myb domain
PfamPF002496.8E-17550IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-30598IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-27658IPR009057Homeodomain-like
CDDcd001671.41E-13849No hitNo description
PROSITE profilePS5129418.71356106IPR017930Myb domain
SMARTSM007171.3E-1556104IPR001005SANT/Myb domain
PfamPF002491.7E-145799IPR001005SANT/Myb domain
CDDcd001671.91E-125999No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2159104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMCSRGHWRP AEDEKLRELV QQFGPHNWNA IAQKLSGRSG KSCRLRWFNQ LDPRINRNPF  60
TEEEEERLLA SHRIHGNRWS VIARFFPGRT DNAVKNHWHV IMARRGRERS KVRPRSLGHD  120
GTAVGPGMMG YKDTDKKRRL GTTTAINYPY SFSHINHFQI LKEFLTGKIG FCNNTTPINE  180
GAVDQTKRPL EFYNFLQVKT DSKKPEVIHN SRKDEEEEED VDSCVPFFDF LSVGNSASHQ  240
GLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-3221051104C-Myb DNA-Binding Domain
1msf_C9e-3221051104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195540.0AY519554.1 Arabidopsis thaliana MYB transcription factor (At1g17950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681197.11e-174PREDICTED: transcriptional activator Myb-like
RefseqXP_013651779.11e-174PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D3DQ451e-163A0A0D3DQ45_BRAOL; Uncharacterized protein
STRINGBra016575.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-154myb domain protein 52